Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g033560.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family BES1
Protein Properties Length: 329aa    MW: 35113.3 Da    PI: 8.8778
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g033560.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       g+++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc eAGwvve+DGttyrkg++p+  +e++g+sa+++p+ss
                       6899************************************************************************.**************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasa 133
                        + s+ ss++asp++sy+ sp+sssfpsps+ d ++++++
                       *********************************9988755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.4E-6231158IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074231.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
TrEMBLM1CP010.0M1CP01_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000715850.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-104BES1 family protein